Loading...
Statistics
Advertisement

Cửa hàng Cương | Chuyên sửa chữa Điện - Máy - Sơn - Tâ ...
www.dienmayxecuong.com/
Chuyên sửa chữa Điện, Máy, Sơn, Tân trang xe tay ga Honda, Xe điện, IC đánh lửa, Gắn báo động chống trộm, cảm ứng xe, quấn ...

Dienmayxecuong.com

Advertisement
Conversion Technology Metas Server
Dienmayxecuong.com is hosted in Vietnam / Hanoi . Dienmayxecuong.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Iframe, Number of used javascripts: 6. First javascripts: Jquery-1.8.3.min.js, Dropdown.js, Scrool-menu-top.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Microsoft-IIS/7.5.

Technologies in use by Dienmayxecuong.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Iframe
  • Javascript
  • JW Player
  • Swf Object

Advertisement

Javascripts

Number of occurences: 6
  • jquery-1.8.3.min.js
  • dropdown.js
  • scrool-menu-top.js
  • owl.carousel.min.js
  • jquery.lazy.js
  • jwplayer.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Social

Number of occurences: 1
  • Facebook Box

Google Analytics ID

  • UA-63550332-3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Dienmayxecuong.com

SSL certificate

    • name: /C=US/ST=Virginia/L=Herndon/O=Parallels, Inc./OU=Parallels Panel/CN=Parallels Panel/emailAddress=info@parallels.com
    • subject:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels, Inc.
      • OU: Parallels Panel
      • CN: Parallels Panel
      • emailAddress: info@parallels.com
    • hash: 8bc540cd
    • issuer:
      • C: US
      • ST: Virginia
      • L: Herndon
      • O: Parallels, Inc.
      • OU: Parallels Panel
      • CN: Parallels Panel
      • emailAddress: info@parallels.com
    • version: 2
    • serialNumber: 53173502
    • validFrom: 140511062156Z
    • validTo: 150511062156Z
    • validFrom_time_t: 1399789316
    • validTo_time_t: 1431325316
    • extensions:
      • subjectKeyIdentifier: 1F:5D:F2:F7:D8:B0:FD:24:A8:1B:8C:C7:EA:F3:8E:CE:23:E1:3B:DB
      • authorityKeyIdentifier: keyid:1F:5D:F2:F7:D8:B0:FD:24:A8:1B:8C:C7:EA:F3:8E:CE:23:E1:3B:DB DirName:/C=US/ST=Virginia/L=Herndon/O=Parallels, Inc./OU=Parallels Panel/CN=Parallels Panel/emailAddress=info@parallels.com serial:03:2B:5C:FE
      • basicConstraints: CA:TRUE

Meta - Dienmayxecuong.com

Number of occurences: 7
  • Name: description
    Content: Chuyên sửa chữa Điện, Máy, Sơn, Tân trang xe tay ga Honda, Xe điện, IC đánh lửa, Gắn báo động chống trộm, cảm ứng xe, quấn đổi mobine các loại
  • Name: keywords
    Content: Sửa chữa xe máy, sua chua xe may, xe honda, IC, xe tay ga, chống trộm, chong trom xe may, cảm ứng xe, cam ung xe, Mobine
  • Name:
    Content:
  • Name: author
    Content: phanthaisonth08a@gmail.com
  • Name: robots
    Content: index,follow
  • Name: format-detection
    Content: telephone=no
  • Name: revisit-after
    Content: 1 days

Server / Hosting

  • IP: 118.69.175.2
  • Latitude: 21.03
  • Longitude: 105.85
  • Country: Vietnam
  • City: Hanoi

Rname

  • ns2.websitenambo.com
  • ns1.websitenambo.com
  • mail.dienmayxecuong.com

Target

  • postmaster.websitenambo.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Content-Length: 126 Content-Type: text/html; charset=UTF-8 Location: vi/ Server: Microsoft-IIS/7.5 X-Powered-By-Plesk: PleskWin X-Powered-By: ASP.NET Date: Mon, 06 Jun 2016 03:25:16 GMT X-Cache: MISS from s_lu10 X-Cache-Lookup: MISS from s_lu10:80 Via: 1.1 s_lu10 (squid/3.5.12) Connection: keep-alive HTTP/1.1 200 OK Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Content-Length: 0 Content-Type: text/html; charset=utf-8 Expires: Thu, 19 Nov 1981 08:52:00 GMT Server: Microsoft-IIS/7.5 Set-Cookie: PHPSESSID=cf8d7c6e2ca423e57b436b29269be0a3; path=/ X-Powered-By-Plesk: PleskWin X-Powered-By: ASP.NET Date: Mon, 06 Jun 2016 03:25:18 GMT X-Cache: MISS from s_lu10 X-Cache-Lookup: MISS from s_lu10:80 Via: 1.1 s_lu10 (squid/3.5.12) Connection: keep-alive

DNS

host: dienmayxecuong.com
  1. class: IN
  2. ttl: 359
  3. type: A
  4. ip: 118.69.175.2
host: dienmayxecuong.com
  1. class: IN
  2. ttl: 360
  3. type: NS
  4. target: ns2.websitenambo.com
host: dienmayxecuong.com
  1. class: IN
  2. ttl: 360
  3. type: NS
  4. target: ns1.websitenambo.com
host: dienmayxecuong.com
  1. class: IN
  2. ttl: 360
  3. type: SOA
  4. mname: ns1.websitenambo.com
  5. rname: postmaster.websitenambo.com
  6. serial: 2016052707
  7. refresh: 14400
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 360
host: dienmayxecuong.com
  1. class: IN
  2. ttl: 360
  3. type: MX
  4. pri: 10
  5. target: mail.dienmayxecuong.com
host: dienmayxecuong.com
  1. class: IN
  2. ttl: 360
  3. type: TXT
  4. txt: v=spf1 a mx ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ienmayxecuong.com, www.dtienmayxecuong.com, www.tienmayxecuong.com, www.dgienmayxecuong.com, www.gienmayxecuong.com, www.dbienmayxecuong.com, www.bienmayxecuong.com, www.dxienmayxecuong.com, www.xienmayxecuong.com, www.dsienmayxecuong.com, www.sienmayxecuong.com, www.dfienmayxecuong.com, www.fienmayxecuong.com, www.dvienmayxecuong.com, www.vienmayxecuong.com, www.dyienmayxecuong.com, www.yienmayxecuong.com, www.dzienmayxecuong.com, www.zienmayxecuong.com, www.daienmayxecuong.com, www.aienmayxecuong.com, www.deienmayxecuong.com, www.eienmayxecuong.com, www.drienmayxecuong.com, www.rienmayxecuong.com, www.denmayxecuong.com, www.direnmayxecuong.com, www.drenmayxecuong.com, www.difenmayxecuong.com, www.dfenmayxecuong.com, www.divenmayxecuong.com, www.dvenmayxecuong.com, www.dikenmayxecuong.com, www.dkenmayxecuong.com, www.di,enmayxecuong.com, www.d,enmayxecuong.com, www.dibenmayxecuong.com, www.dbenmayxecuong.com, www.digenmayxecuong.com, www.dgenmayxecuong.com, www.ditenmayxecuong.com, www.dtenmayxecuong.com, www.diyenmayxecuong.com, www.dyenmayxecuong.com, www.diuenmayxecuong.com, www.duenmayxecuong.com, www.dijenmayxecuong.com, www.djenmayxecuong.com, www.dimenmayxecuong.com, www.dmenmayxecuong.com, www.dinenmayxecuong.com, www.dnenmayxecuong.com, www.dinmayxecuong.com, www.diexnmayxecuong.com, www.dixnmayxecuong.com, www.diesnmayxecuong.com, www.disnmayxecuong.com, www.diewnmayxecuong.com, www.diwnmayxecuong.com, www.diernmayxecuong.com, www.dirnmayxecuong.com, www.diefnmayxecuong.com, www.difnmayxecuong.com, www.dievnmayxecuong.com, www.divnmayxecuong.com, www.diecnmayxecuong.com, www.dicnmayxecuong.com, www.dieqnmayxecuong.com, www.diqnmayxecuong.com, www.dieanmayxecuong.com, www.dianmayxecuong.com, www.dieynmayxecuong.com, www.diynmayxecuong.com, www.diemayxecuong.com, www.diennmayxecuong.com, www.dienmayxecuong.com, www.dienhmayxecuong.com, www.diehmayxecuong.com, www.dienjmayxecuong.com, www.diejmayxecuong.com, www.dienkmayxecuong.com, www.diekmayxecuong.com, www.dienlmayxecuong.com, www.dielmayxecuong.com, www.dien mayxecuong.com, www.die mayxecuong.com, www.dienayxecuong.com, www.dienmpayxecuong.com, www.dienpayxecuong.com, www.dienmoayxecuong.com, www.dienoayxecuong.com, www.dienmiayxecuong.com, www.dieniayxecuong.com, www.dienmkayxecuong.com, www.dienkayxecuong.com, www.dienm.ayxecuong.com, www.dien.ayxecuong.com, www.dienmuayxecuong.com, www.dienuayxecuong.com, www.dienmjayxecuong.com, www.dienjayxecuong.com, www.dienmnayxecuong.com, www.diennayxecuong.com, www.dienm-ayxecuong.com, www.dien-ayxecuong.com, www.dienmyxecuong.com, www.dienmaoyxecuong.com, www.dienmoyxecuong.com, www.dienmapyxecuong.com, www.dienmpyxecuong.com, www.dienma9yxecuong.com, www.dienm9yxecuong.com, www.dienmayxecuong.com, www.dienmyxecuong.com, www.dienmaiyxecuong.com, www.dienmiyxecuong.com, www.dienmauyxecuong.com, www.dienmuyxecuong.com, www.dienmaxecuong.com, www.dienmayzxecuong.com, www.dienmazxecuong.com, www.dienmayaxecuong.com, www.dienmaaxecuong.com, www.dienmaysxecuong.com, www.dienmasxecuong.com, www.dienmaydxecuong.com, www.dienmadxecuong.com, www.dienmayxecuong.com, www.dienmaxecuong.com, www.dienmaycxecuong.com, www.dienmacxecuong.com, www.dienmay xecuong.com, www.dienma xecuong.com, www.dienmayecuong.com, www.dienmayxqecuong.com, www.dienmayqecuong.com, www.dienmayxecuong.com, www.dienmayecuong.com, www.dienmayxaecuong.com, www.dienmayaecuong.com, www.dienmayxsecuong.com, www.dienmaysecuong.com, www.dienmayxdecuong.com, www.dienmaydecuong.com, www.dienmayxeecuong.com, www.dienmayeecuong.com, www.dienmayxcuong.com, www.dienmayxexcuong.com, www.dienmayxxcuong.com, www.dienmayxescuong.com, www.dienmayxscuong.com, www.dienmayxewcuong.com, www.dienmayxwcuong.com, www.dienmayxercuong.com, www.dienmayxrcuong.com, www.dienmayxefcuong.com, www.dienmayxfcuong.com, www.dienmayxevcuong.com, www.dienmayxvcuong.com, www.dienmayxeccuong.com, www.dienmayxccuong.com, www.dienmayxeqcuong.com, www.dienmayxqcuong.com, www.dienmayxeacuong.com, www.dienmayxacuong.com, www.dienmayxeycuong.com, www.dienmayxycuong.com,

Other websites we recently analyzed

  1. Site Exception
    Allentown (United States) - 209.235.229.212
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 2
  2. Stroje sportowe, komplety sportowe - Cooltec - stroje sportowe
    Jesteśmy producentem strojów sportowych. W naszej ofercie kompletne stroje sportowe, spodenki, koszulki
    Nürnberg (Germany) - 88.198.26.249
    G Analytics ID: UA-40426069-21
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Php, Google Analytics, Prestashop
    Number of Javascript: 11
    Number of meta tags: 6
  3. Meaningful Directions Therapeutic Services
    At Meaningful Directions, our highly trained, experienced clinicians are here to assist families, couples and individuals of all ages through life's difficulties. The diverse backgrounds of our staff counselors provide the opportunity for clients to be matched appropriately to a clinician who can meet their unique needs, promoting a successful and positive experience. We also understand the connection between various aspects of an individual's life and their work in a counseling setting. We value collaborative efforts between the clinician, family, schools supports and outside service providers. Whether marital or family discord are impacting your life or your child's behavior has become difficult at home or in school, or you simply seek an empathetic ear, Meaningful Directions can help.
    Scottsdale (United States) - 97.74.144.203
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 2
    Number of meta tags: 3
  4. www.casasillinois.com
    Scottsdale (United States) - 184.168.221.26
    Server software: Microsoft-IIS/7.5
    Technology: Html
  5. Private Krankenversicherung - Kostenloses Angebot zur privaten Krankenversicherung anfordern
    Private Krankenversicherung - Kostenloses Angebot zur privaten Krankenversicherung anfordern
    Germany - 31.185.110.57
    Server software: Apache/2.4.10 (Debian)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 3
  6. RankUp Running
    New York (United States) - 104.236.221.201
    Server software: Apache/2.4.7 (Ubuntu)
    Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery UI, Php, Facebook Box
    Number of Javascript: 9
    Number of meta tags: 2
  7. landwirtschaftliche-direktvermarktung.de
    Germany - 82.165.89.168
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  8. seakayakbrands.com
    New York (United States) - 69.172.201.153
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  9. IVY'S ATTIC - Englewood, Florida Furniture Store
    IVY'S ATTIC Englewood, Florida selection of sofas, recliners, chairs, tables, accent tables, dining furniture, office furniture, living room furniture, bedroom furniture and more.
    Boardman (United States) - 52.26.98.107
    Server software: Microsoft-IIS/8.5
    Technology: Google Adsense, CSS, Html, Javascript, jQuery Cycle, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 2
  10. topsecurityfilesafe.com
    Scottsdale (United States) - 184.168.221.35
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites